PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010930725.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 295aa    MW: 33335.9 Da    PI: 8.117
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010930725.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.42e-5181321128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtd+elv++yL++k++g ++++  +i+e+d+yk++Pw+Lp  +  +ekewyfFs+rd+ky++g+r+nra+ sgyWkatg dk++ s 
  XP_010930725.1   8 LPPGFRFHPTDDELVMHYLCRKCAGLPISV-PIIAEIDLYKFDPWQLPGVALYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPIGS- 100
                     79****************************.88***************6555689*************************************99. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       + v +kk Lvfy g+apkgekt+W+mheyrl
  XP_010930725.1 101 -PKPVAIKKALVFYAGKAPKGEKTNWIMHEYRL 132
                     .789***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-625158IPR003441NAC domain
PROSITE profilePS5100559.6038158IPR003441NAC domain
PfamPF023651.5E-269132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MSGEDLQLPP GFRFHPTDDE LVMHYLCRKC AGLPISVPII AEIDLYKFDP WQLPGVALYG  60
EKEWYFFSPR DRKYPNGSRP NRAAGSGYWK ATGADKPIGS PKPVAIKKAL VFYAGKAPKG  120
EKTNWIMHEY RLAGVDRSAR KKNSLRLDDW VLCRIYNKKG VVEKQTSPYR NSAGSRNIVP  180
EPCSPEQKPE IISHVPPPVS SHVPPAPPLT DLFYFDASES LPRLHADSSC SEHVLSPEFT  240
CEREVQSRPS WRDWERALGF DTTSEVATGT FPPLSPPEGF RDPLQDVFMY LQKPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-79516412174Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00121DAPTransfer from AT1G01720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010930725.10.0PREDICTED: NAC domain-containing protein 48-like
SwissprotQ7F2L31e-134NAC48_ORYSJ; NAC domain-containing protein 48
TrEMBLW9R9L01e-145W9R9L0_9R
STRINGVIT_18s0001g02300.t011e-141(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34173782
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-126NAC family protein